WASF3/WAVE3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54993

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Chicken

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to WASF3(WAS protein family, member 3) The peptide sequence was selected from the middle region of WASF3. Peptide sequence RIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for WASF3/WAVE3 Antibody - BSA Free

Western Blot: WASF3/WAVE3 Antibody [NBP1-54993]

Western Blot: WASF3/WAVE3 Antibody [NBP1-54993]

Western Blot: WASF3/WAVE3 Antibody [NBP1-54993] - IAH30, DF-1, MSB-1 (fibroblasts, lymphomas, macrophage cell line), Antibody Titration: 0.2-1 ug/ml
Western Blot: WASF3/WAVE3 Antibody [NBP1-54993]

Western Blot: WASF3/WAVE3 Antibody [NBP1-54993]

Western Blot: WASF3/WAVE3 Antibody [NBP1-54993] - Sample Type: 1. DF-1 cells (0.5x10^6 cells loaded) 2. MSB-1 cells (0.5x10^6 cells loaded) Primary Dilution: 1:1000 Secondary Antibody : Goat anti-rabbit IgG (whole molecule) peroxidase Secondary Dilution: 1:10,000 Image Submitted By: Yongxiu Yao Institute

Applications for WASF3/WAVE3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WASF3/WAVE3

WASF3 is a member of the Wiskott-Aldrich syndrome protein family. It is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function.This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Wiskott-Aldrich Syndrome Protein Family Member 3

Alternate Names

Brush-1, SCAR3, WAVE3

Gene Symbol

WASF3

UniProt

Additional WASF3/WAVE3 Products

Product Documents for WASF3/WAVE3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WASF3/WAVE3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WASF3/WAVE3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WASF3/WAVE3 Antibody - BSA Free and earn rewards!

Have you used WASF3/WAVE3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...