WBP2NL Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88585

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all WBP2NL Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human WBP2NL. Peptide sequence: MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for WBP2NL Antibody - BSA Free

Western Blot: WBP2NL Antibody [NBP2-88585]

Western Blot: WBP2NL Antibody [NBP2-88585]

Western Blot: WBP2NL Antibody [NBP2-88585] - WB Suggested Anti-WBP2NL Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Placenta

Applications for WBP2NL Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WBP2NL

Regulated by GSTP1 and playing a role in cell activation, WBP2NL is a sperm-specific WW domain-binding protein. It promotes meiotic resumption and may play a role in pronuclear formation during oocyte fertilization. Other biological processes involved with WBP2NL include egg activation, female pronucleus assembly and male pronucleus assembly. Mitral valve stenosis, cerebrovascular accident and pulmonary edema are diseases associated with WBP2NL.

Alternate Names

MGC26816, PAWPFLJ26145, postacrosomal sheath WW domain-binding protein, WBP2 N-terminal like, WW domain-binding protein 2-like

Gene Symbol

WBP2NL

Additional WBP2NL Products

Product Documents for WBP2NL Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WBP2NL Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WBP2NL Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WBP2NL Antibody - BSA Free and earn rewards!

Have you used WBP2NL Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies