WDFY3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09286

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all WDFY3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human WDFY3 (NP_848698). Peptide sequence LEVMVNLLHKYAALLKDPTQALNEQGDSRNNSSVEDQKHLALLVMETLTV

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

90 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for WDFY3 Antibody - BSA Free

Western Blot: WDFY3 Antibody [NBP3-09286]

Western Blot: WDFY3 Antibody [NBP3-09286]

Western Blot: WDFY3 Antibody [NBP3-09286] - Western blot analysis using NBP3-09286 on Human Muscle as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for WDFY3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 5 using NBP3-09286 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WDFY3

The WDFY3 gene encodes a protein which contains WD repeats and an FYVE domain. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined. (provided by RefSeq)

Alternate Names

Alfy, Autophagy-linked FYVE protein, KIAA0993MGC16461, WD repeat and FYVE domain containing 3, WD repeat and FYVE domain-containing protein 3, ZFYVE25

Gene Symbol

WDFY3

Additional WDFY3 Products

Product Documents for WDFY3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WDFY3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WDFY3 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used WDFY3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 的 1 review Showing All
Filter By:
Clear Filters X
  • WDFY3 Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Mouse brain
    Species: Mouse
    Verified Customer | Posted 03/20/2024
    Coip performed for Wdfy3, did western and probed with ROBO3 antibody
    WDFY3 Antibody - BSA Free NBP3-09286
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 的 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies