WDR57 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86070

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all WDR57 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human WDR57. Peptide sequence: SASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for WDR57 Antibody - BSA Free

Western Blot: WDR57 Antibody [NBP2-86070]

Western Blot: WDR57 Antibody [NBP2-86070]

Western Blot: WDR57 Antibody [NBP2-86070] - Host: Rabbit. Target Name: SNRNP40. Sample Type: Fetal Kidney lysates. Antibody Dilution: 1.0ug/ml

Applications for WDR57 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WDR57

WDR57 encodes a component of the U5 small nuclear ribonucleoprotein (snRNP) particle. The U5 snRNP is part of the spliceosome, a multiprotein complex that catalyzes the removal of introns from pre-messenger RNAs. [provided by RefSeq]

Alternate Names

38 kDa-splicing factor, hPRP8BP, Prp8-binding protein, PRP8BP40K, PRPF8BPFLJ41108, RP11-490K7.3, SFP38, small nuclear ribonucleoprotein 40kDa (U5), SPF38MGC1910, U5 small nuclear ribonucleoprotein 40 kDa protein, U5 snRNP 40 kDa protein, U5 snRNP-specific 40 kDa protein, U5 snRNP-specific 40 kDa protein (hPrp8-binding), U5-40K, U5-40kD protein, WD repeat domain 57 (U5 snRNP specific), WD repeat-containing protein 57, WDR57

Gene Symbol

SNRNP40

Additional WDR57 Products

Product Documents for WDR57 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WDR57 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WDR57 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WDR57 Antibody - BSA Free and earn rewards!

Have you used WDR57 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies