WDR79 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-15968

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 62-160 of human WDR79 (NP_060551.2). AVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANGPELGSGKAMEDTSGEPAAEDEGDTAWNYSFSQLPRFLSGS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for WDR79 Antibody - Azide and BSA Free

Western Blot: WDR79 AntibodyAzide and BSA Free [NBP3-15968]

Western Blot: WDR79 AntibodyAzide and BSA Free [NBP3-15968]

Western Blot: WDR79 Antibody [NBP3-15968] - Western blot analysis of extracts of Mouse kidney, using WDR79 antibody (NBP3-15968) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Applications for WDR79 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: WDR79

WD-repeat domain 79 (WDR79) contains six WD (tryptophan-aspartate) repeat domains found in a number of proteins that function as adaptor molecules in signal transduction and cytoskeletal organization. The WD repeat is defined by four or more repeating units of a conserved core of approximately 40 amino acids ending with tryptophan-aspartic acid (WD). WD repeats may serve as sites of protein-protein interaction for adaptor proteins and facilitate multiprotein complex formation. The function of the WDR79 protein has not been characterized, however significant and consistent single nucleotide polymorphisms in the WDR79 gene have been found to be associated with ER negative breast cancer.

Alternate Names

FLJ10385, TCAB1WDR79telomerase Cajal body protein 1, WD repeat containing, antisense to TP53, WD repeat domain 79, WD repeat-containing protein 79, WD40 protein Wrap53, WD40 repeat-containing protein encoding RNA antisense to p53, WD-encoding RNA antisense to p53

Gene Symbol

WRAP53

Additional WDR79 Products

Product Documents for WDR79 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WDR79 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for WDR79 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review WDR79 Antibody - Azide and BSA Free and earn rewards!

Have you used WDR79 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...