Xrn1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57281

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Xrn1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to XRN1(5'-3' exoribonuclease 1) The peptide sequence was selected from the middle region of XRN1. Peptide sequence LPQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKM. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

194 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Xrn1 Antibody - BSA Free

Western Blot: Xrn1 Antibody [NBP1-57281]

Western Blot: Xrn1 Antibody [NBP1-57281]

Western Blot: Xrn1 Antibody [NBP1-57281] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Applications for Xrn1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Xrn1

SEP1 (XRN1) localizes to cytoplasmic foci containing a complex of mRNA-degrading enzymes. In addition to mRNA metabolism, yeast Sep1 has been implicated in a variety of nuclear and cytoplasmic functions, including homologous recombination, meiosis, telomere maintenance, and microtubule assembly.SEP1 localizes to cytoplasmic foci containing a complex of mRNA-degrading enzymes. In addition to mRNA metabolism, yeast Sep1 has been implicated in a variety of nuclear and cytoplasmic functions, including homologous recombination, meiosis, telomere maintenance, and microtubule assembly.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-67 BX640905.1 1-67 68-5188 AY137776.1 1-5121 5189-5269 BG197321.1 308-388 5270-10092 AC023508.16 31718-36540 c

Alternate Names

5'-3' exoribonuclease 1, DKFZp434P0721, DKFZp686B22225, DKFZp686F19113, EC 3.1.11.-, SEP1FLJ41903, Strand-exchange protein 1 homolog

Gene Symbol

XRN1

UniProt

Q8IZH2 (Human)

Additional Xrn1 Products

Product Documents for Xrn1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Xrn1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Xrn1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Xrn1 Antibody - BSA Free and earn rewards!

Have you used Xrn1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies