ZCCHV Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88613

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ZCCHV Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZCCHV. Peptide sequence: ESGTWIQYGEEKDKRKNSNVDSSYLESLYQSCPRGVVPFQAGSRNYELSF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ZCCHV Antibody - BSA Free

Western Blot: ZCCHV Antibody [NBP2-88613]

Western Blot: ZCCHV Antibody [NBP2-88613]

Western Blot: ZCCHV Antibody [NBP2-88613] - Host: Rabbit. Target Name: ZC3HAV1. Sample Tissue: Human Lung Tumor lysates. Antibody Dilution: 1ug/ml

Applications for ZCCHV Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZCCHV

The ZCCHV gene encodes a CCCH-type zinc finger protein that is thought to prevent infection by retroviruses. Studies of the rat homolog indicate that the protein may primarily function to inhibit viral gene expression and induce an innate immunity to viral inf

Alternate Names

FLB6421DKFZp686O19171, FLJ13288antiviral 1, ZAPDKFZp686F2052, ZC3HDC2DKFZp686H1869, Zinc finger antiviral protein, Zinc finger CCCH domain-containing protein 2, zinc finger CCCH-type antiviral protein 1, zinc finger CCCH-type, antiviral 1

Gene Symbol

ZC3HAV1

Additional ZCCHV Products

Product Documents for ZCCHV Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZCCHV Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZCCHV Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZCCHV Antibody - BSA Free and earn rewards!

Have you used ZCCHV Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies