ZFP95 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10945

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP95 (NP_055384). Peptide sequence VKIEEVADVAVSFILEEWGHLDQSQKSLYRDDRKENYGSITSMGYESRDN

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

97 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ZFP95 Antibody - BSA Free

Western Blot: ZFP95 Antibody [NBP3-10945]

Western Blot: ZFP95 Antibody [NBP3-10945]

Western Blot: ZFP95 Antibody [NBP3-10945] - Western blot analysis using NBP3-10945 on Human Stomach as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for ZFP95 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZFP95

ZFP95 encodes a zinc finger protein of the Kruppel family. The protein contains a SCAN box and a KRAB A domain. A similar protein in mouse is differentially expressed in spermatogenesis. Two alternatively spliced transcript variants differing only in the 5' UTR have been described. Additional variants have been found, but their full-length sequences have not been determined. [provided by RefSeq]

Alternate Names

FLJ39233, KIAA1015, MGC33710, ZFP95, Zfp-95, Zinc finger protein 95 homolog, zinc finger protein 95 homolog (mouse), zinc finger protein homologous to Zfp95 in mouse, zinc finger protein with KRAB and SCAN domains 5, zinc finger with KRAB and SCAN domains 5, ZNF914

Gene Symbol

ZKSCAN5

Additional ZFP95 Products

Product Documents for ZFP95 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZFP95 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZFP95 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZFP95 Antibody - BSA Free and earn rewards!

Have you used ZFP95 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...