ZNF160 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83828

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ZNF160 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZNF160. Peptide sequence: KVFTQNSHLANHQRTHTGEKPYRCNECGKAFSVRSSLTTHQAIHTGKKPY The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ZNF160 Antibody - BSA Free

Western Blot: ZNF160 Antibody [NBP2-83828]

Western Blot: ZNF160 Antibody [NBP2-83828]

Western Blot: ZNF160 Antibody [NBP2-83828] - Host: Rabbit. Target Name: ZN160. Sample Type: PANC1 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for ZNF160 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNF160

The protein encoded by the ZNF160 gene is a Kruppel-related zinc finger protein which is characterized by the presence of an N-terminal repressor domain, the Kruppel-associated box (KRAB). The KRAB domain is a potent repressor of transcription; thus this protein may function in transcription regulation. Three alternative transcripts encoding the same protein have been described. [provided by RefSeq]

Alternate Names

DKFZp686B16128, F11, FLJ00032, HKr18Zinc finger protein HZF5, HZF5, KIAA1611Zinc finger protein Kr18, KR18, KRAB zinc finger protein KR18, zinc finger protein 160, zinc finger protein 5

Gene Symbol

ZNF160

Additional ZNF160 Products

Product Documents for ZNF160 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZNF160 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNF160 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNF160 Antibody - BSA Free and earn rewards!

Have you used ZNF160 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies