ZNF202 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84350

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ZNF202 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF202. Peptide sequence: LDPTQKEFYGEYVLEEDCGIVVSLSFPIPRPDEISQVREEEPWVPDIQEP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ZNF202 Antibody - BSA Free

Western Blot: ZNF202 Antibody [NBP2-84350]

Western Blot: ZNF202 Antibody [NBP2-84350]

Western Blot: ZNF202 Antibody [NBP2-84350] - WB Suggested Anti-ZNF202 Antibody Titration: 0.2-1 ug/ml. Positive Control: Jurkat cell lysateZNF202 is supported by BioGPS gene expression data to be expressed in Jurkat

Applications for ZNF202 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNF202

Transcriptional repressor that binds to elements found predominantly in genes that participate in lipid metabolism. Among its targets are structural components of lipoprotein particles (apolipoproteins AIV, CIII, and E), enzymes involved in lipid processing (lipoprotein lipase, lecithin cholesteryl ester transferase), transporters involved in lipid homeostasis (ABCA1, ABCG1), and several genes involved in processes related to energy metabolism and vascular disease

Alternate Names

zinc finger protein 202, ZKSCAN10Zinc finger protein with KRAB and SCAN domains 10

Gene Symbol

ZNF202

Additional ZNF202 Products

Product Documents for ZNF202 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZNF202 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNF202 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNF202 Antibody - BSA Free and earn rewards!

Have you used ZNF202 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies