ZNHIT3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86564

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ZNHIT3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human ZNHIT3. Peptide sequence: HKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLNSDEEEDRV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ZNHIT3 Antibody - BSA Free

Western Blot: ZNHIT3 Antibody [NBP2-86564]

Western Blot: ZNHIT3 Antibody [NBP2-86564]

Western Blot: ZNHIT3 Antibody [NBP2-86564] - WB Suggested Anti-ZNHIT3 Antibody Titration: 0.2-1 ug/ml. Positive Control: Human Placenta

Applications for ZNHIT3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNHIT3

ZNHIT3/TRIP3 interacts with HNF-4 alpha, a transcription factor involved in glucose metabolism. As a protein associated with HNF-4, ZNHIT3/TRIP3 functions as a transcriptional coactivator. Alternate names for ZNHIT3/TRIP3 include Zinc finger HIT domain-containing protein 3, thyroid receptor-interacting protein 3, and HNF4a coactivator.

Alternate Names

HNF-4a coactivator, Thyroid hormone receptor interactor 3TR-interacting protein 3, Thyroid receptor-interacting protein 3, TRIP-3, TRIP3thyroid receptor interacting protein 3, zinc finger HIT domain-containing protein 3, zinc finger, HIT domain containing 3, zinc finger, HIT type 3, zinc finger, HIT-type containing 3

Gene Symbol

ZNHIT3

Additional ZNHIT3 Products

Product Documents for ZNHIT3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZNHIT3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNHIT3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNHIT3 Antibody - BSA Free and earn rewards!

Have you used ZNHIT3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies