ABCA9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-68700

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ABCA9 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: NCFPVLLDVISNGLLGIFNSSEHIQTDRSTFFEEHMDYEYGYR

Reactivity Notes

Mouse 84%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ABCA9 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ABCA9 Antibody [NBP2-68700]

Immunocytochemistry/ Immunofluorescence: ABCA9 Antibody [NBP2-68700]

Immunocytochemistry/Immunofluorescence: ABCA9 Antibody [NBP2-68700] - Staining of human cell line ASC TERT1 shows localization to endoplasmic reticulum.

Applications for ABCA9 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABCA9

ABCA9 is a member of the superfamily of ATP-binding cassette (ABC) transporters and the encoded protein contains two transmembrane domains and two nucleotide binding folds. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This gene is a member of the ABC1 subfamily and is clustered with four other ABC1 family members on chromosome 17q24. Transcriptional expression of this gene is induced during monocyte differentiation into macrophages and is suppressed by cholesterol import. [provided by RefSeq]

Alternate Names

ATP-binding cassette A9, ATP-binding cassette sub-family A member 9, ATP-binding cassette, sub-family A (ABC1), member 9, DKFZp686F2450, EC 3.6.3, EC 3.6.3.41, EST640918, MGC75415

Gene Symbol

ABCA9

Additional ABCA9 Products

Product Documents for ABCA9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ABCA9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ABCA9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ABCA9 Antibody - BSA Free and earn rewards!

Have you used ABCA9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies