AFF4 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-89220PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Applications

Antibody Competition
View all AFF4 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AFF4.

Source: E. coli

Amino Acid Sequence: QGTGNSYTDTSGPKETSSATPGRDSKTIQKGSESGRGRQKSPAQSDSTTQRRTVGKKQPKKAEKAAAEEPRGGLKIESETPVDLASSMPSSRHKAATKGSRKPNIKKESKSSPRPTAEKKKYKSTSKSSQKS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89220.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-89220PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: AFF4

AFF4, or AF4/FMR2 family member 4, contains a 127 kDa, 98 kDa, and 39 kDa isoform, and is involved in the process of improving the catalytic rate of RNA polymerase II transcription. Disease research is currently being conducted with AFF4 on its relation to acute lymphoblastic leukemia, as well as other types of leukemia. This protein interacts with SIAH1, CCNT1, MLLT3, MLLT1, and MED10 during the regulation of DNA-dependent transcription and the transcription of RNA polymerase II.

Alternate Names

AF4/FMR2 family, member 4, AF5Q31AF4/FMR2 family member 4, ALL1-fused gene from chromosome 5q31 protein, Major CDK9 elongation factor-associated protein, MCEFALL1 fused gene from 5q31, MGC75036, Protein AF-5q31

Gene Symbol

AFF4

Additional AFF4 Products

Product Documents for AFF4 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AFF4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for AFF4 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review AFF4 Recombinant Protein Antigen and earn rewards!

Have you used AFF4 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes