Apc11 Antibody (1B4-1A4) - Azide and BSA Free

Novus Biologicals | Catalog # H00051529-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA, Proximity Ligation Assay

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 1B4-1A4

Format

Azide and BSA Free
View all Apc11 Primary Antibodies »

Product Specifications

Immunogen

ANAPC11 (AAH00607, 1 a.a. ~ 54 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGPGPVGKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE

Reactivity Notes

Human. Other species not tested.

Specificity

ANAPC11 - APC11 anaphase promoting complex subunit 11 homolog (yeast)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for Apc11 Antibody (1B4-1A4) - Azide and BSA Free

Sandwich ELISA: Apc11 Antibody (1B4-1A4) [H00051529-M01] - Detection limit for recombinant GST tagged ANAPC11 is approximately 0.03ng/ml as a capture antibody.
Proximity Ligation Assay: Apc11 Antibody (1B4-1A4) [H00051529-M01]

Proximity Ligation Assay: Apc11 Antibody (1B4-1A4) [H00051529-M01]

Proximity Ligation Assay: Apc11 Antibody (1B4-1A4) [H00051529-M01] - Analysis of protein-protein interactions between CDC20 and ANAPC11. HeLa cells were stained with anti-CDC20 rabbit purified polyclonal 1:1200 and anti-ANAPC11 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Applications for Apc11 Antibody (1B4-1A4) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Apc11

APC11 (anaphase-promoting complex subunit 11) is a member of the E3 enzyme family. This protein contains a RING-H2 domain and has a molecular weight of approximately 9.8 kD. The APC11 protein is distributed diffusely in the cytoplasm and is located in the nucleus with discrete accumulation in granular structures. The APC11 protein is a probable catalytic unit in the APC complex. The APC11 protein functions with other members of the APC complex as a multisubunit cell cycle ubiquitin ligase, and a regulator of sister chromatid separation by degrading securins. In addition, this protein functions in ubiquitin-dependent cyclin catabolism, metaphase/anaphase transition, and spindle elongation. The APC11 protein comprises one subunit of the anaphase promoting complex including APC1-8, and other probable complex proteins APC9-11, Cdc26, Mnd2, Swm1. The APC complex is inactivated by protein kinase A and is activated by CDC20 and Cdh1. In addition to the APC complex proteins, APC11 has been shown to interact with Ubc4. The Poly6116 antibody has been shown to be useful for Western blotting of the human and mouse APC11 protein.

Alternate Names

anaphase promoting complex subunit 11, anaphase promoting complex subunit 11 (yeast APC11 homolog), anaphase-promoting complex subunit 11, APC11 anaphase promoting complex subunit 11 homolog, APC11Hepatocellular carcinoma-associated RING finger protein, Apc11p, Cyclosome subunit 11, HSPC214, MGC882

Entrez Gene IDs

51529 (Human)

Gene Symbol

ANAPC11

UniProt

AAH00607 (Human)

Additional Apc11 Products

Product Documents for Apc11 Antibody (1B4-1A4) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Apc11 Antibody (1B4-1A4) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Apc11 Antibody (1B4-1A4) - Azide and BSA Free

Customer Reviews for Apc11 Antibody (1B4-1A4) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Apc11 Antibody (1B4-1A4) - Azide and BSA Free and earn rewards!

Have you used Apc11 Antibody (1B4-1A4) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies