APOBEC3B Antibody (1M8K2)

Novus Biologicals | Catalog # NBP3-33406

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 1M8K2
View all APOBEC3B Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 120-220 of human APOBEC3B (NP_004891.5).

Sequence:
AARLYYYWERDYRRALCRLSQAGARVTIMDYEEFAYCWENFVYNEGQQFMPWYKFDENYAFLHRTLKEILRYLMDPDTFTFNFNNDPLVLRRRQTYLCYEV

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for APOBEC3B Antibody (1M8K2)

APOBEC3B Antibody (1M8K2)

Western Blot: APOBEC3B Antibody (1M8K2) [NBP3-33406] -

Western Blot: APOBEC3B Antibody (1M8K2) [NBP3-33406] - Western blot analysis of various lysates, using APOBEC3B Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.

Applications for APOBEC3B Antibody (1M8K2)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: APOBEC3B

The APOBEC3B gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in acluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that arestructurally and func

Alternate Names

APOBEC1L, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3B, ARCD3, ARP4, bK150C2.2, cytidine deaminase, DJ742C19.2, EC 3.5.4, EC 3.5.4.-, FLJ21201, phorbolin 3, Phorbolin-1-related protein, Phorbolin-2/3, PHRBNLphorbolin 2, probable DNA dC->dU-editing enzyme APOBEC-3B

Gene Symbol

APOBEC3B

Additional APOBEC3B Products

Product Documents for APOBEC3B Antibody (1M8K2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for APOBEC3B Antibody (1M8K2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for APOBEC3B Antibody (1M8K2)

There are currently no reviews for this product. Be the first to review APOBEC3B Antibody (1M8K2) and earn rewards!

Have you used APOBEC3B Antibody (1M8K2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies