Apolipoprotein C1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49010

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Apolipoprotein C1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Apolipoprotein C1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Apolipoprotein C1 Antibody [NBP2-49010]

Immunohistochemistry-Paraffin: Apolipoprotein C1 Antibody [NBP2-49010]

Immunohistochemistry-Paraffin: Apolipoprotein C1 Antibody [NBP2-49010] - Staining of human skin shows very weak granular cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Apolipoprotein C1 Antibody [NBP2-49010]

Immunohistochemistry-Paraffin: Apolipoprotein C1 Antibody [NBP2-49010]

Immunohistochemistry-Paraffin: Apolipoprotein C1 Antibody [NBP2-49010] - Staining of human endometrium shows very weak granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Apolipoprotein C1 Antibody [NBP2-49010]

Immunohistochemistry-Paraffin: Apolipoprotein C1 Antibody [NBP2-49010]

Immunohistochemistry-Paraffin: Apolipoprotein C1 Antibody [NBP2-49010] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Apolipoprotein C1 Antibody [NBP2-49010]

Immunohistochemistry-Paraffin: Apolipoprotein C1 Antibody [NBP2-49010]

Immunohistochemistry-Paraffin: Apolipoprotein C1 Antibody [NBP2-49010] - Staining of human pancreas shows very weak granular cytoplasmic positivity in exocrine glandular cells.

Applications for Apolipoprotein C1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Apolipoprotein C1

Apolipoprotein CI is encoded by this gene is a member of the apolipoprotein C1 family. This gene is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages. A pseudogene of this gene is located 4 kb downstream in the same orientation, on the same chromosome. This gene is mapped to chromosome 19, where it resides within a apolipoprotein gene cluster. Alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined.

Alternate Names

APOC1, APOC1B, apo-CIB, ApoC-IB, Apolipoprotein C1, apolipoprotein C-I

Gene Symbol

APOC1

Additional Apolipoprotein C1 Products

Product Documents for Apolipoprotein C1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Apolipoprotein C1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Apolipoprotein C1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Apolipoprotein C1 Antibody - BSA Free and earn rewards!

Have you used Apolipoprotein C1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies