Bcl3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57127

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%), Rat (92%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Bcl3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Bcl3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Bcl3 Antibody [NBP2-57127]

Immunocytochemistry/ Immunofluorescence: Bcl3 Antibody [NBP2-57127]

Immunocytochemistry/Immunofluorescence: Bcl3 Antibody [NBP2-57127] - Staining of human cell line HeLa shows localization to nucleoplasm, cytosol, midbody & vesicles.

Applications for Bcl3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Bcl3

The transcriptional coactivator, B-cell lymphoma 3-encoded protein (Bcl3) is a member of the inhibitor of nuclear factor kappaB (NF-kappaB) family. Also a known regulator of NF-kappaB, Bcl-3 plays a critical role in the development of normal immune responses. Specifically, Bcl 3 regulates transcriptional activation of NF-kappa-B target genes, by inhibiting the nuclear translocation of the NF-kappa-B p50 subunit in the cytoplasm and acting as transcriptional activator that promotes transcription of NF-kappa-B target genes in the nucleus.

Bcl-3 also contributes to the regulation of cell proliferation, and influences the survival of T cells when they are activated as a result of an immune response. It also contributes to chronic inflammatory disease states such as osteoarthritis and rheumatoid arthritis, and defects in Bcl3 may lead to B-cell chronic lymphocytic leukemia. Therefore, Bcl3 antibodies can be useful tools for studying autoimmune disease and cancer development.

Alternate Names

B-cell CLL/lymphoma 3, B-cell leukemia/lymphoma 3, B-cell lymphoma 3 protein, B-cell lymphoma 3-encoded protein, BCL-3, BCL4, chronic lymphatic leukemia protein, D19S37, Proto-oncogene BCL3

Gene Symbol

BCL3

Additional Bcl3 Products

Product Documents for Bcl3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Bcl3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Bcl3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Bcl3 Antibody - BSA Free and earn rewards!

Have you used Bcl3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies