CDC25C Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57705

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CDC25C Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit CDC25C Antibody - BSA Free (NBP2-57705) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for CDC25C Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CDC25C Antibody [NBP2-57705]

Immunocytochemistry/ Immunofluorescence: CDC25C Antibody [NBP2-57705]

Immunocytochemistry/Immunofluorescence: CDC25C Antibody [NBP2-57705] - Staining of human cell line U-2 OS shows localization to nuclear speckles.

Applications for CDC25C Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CDC25C

Cdc25C is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.

Long Name

Cell Division Cycle 25C

Alternate Names

CDC 25, CDC25, cell division cycle 25 homolog C (S. cerevisiae), cell division cycle 25 homolog C (S. pombe), cell division cycle 25C, Dual specificity phosphatase Cdc25C, EC 3.1.3.48, mitosis inducer CDC25, M-phase inducer phosphatase 3, phosphotyrosine phosphatase

Gene Symbol

CDC25C

Additional CDC25C Products

Product Documents for CDC25C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CDC25C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cell Cycle
Phosphatases and Regulators

Customer Reviews for CDC25C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CDC25C Antibody - BSA Free and earn rewards!

Have you used CDC25C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies