Recombinant Human CDK20 GST (N-Term) Protein
Novus Biologicals | Catalog # H00023552-P01
![SDS-PAGE: Recombinant Human CDK20 GST (N-Term) Protein [H00023552-P01]](https://resources.rndsystems.com/images/products/Recombinant-Human-CDK20-Protein-SDS-Page-H00023552-P01-img0002.jpg "SDS-PAGE: Recombinant Human CDK20 GST (N-Term) Protein [H00023552-P01]")
Key Product Details
Source
Tag
Applications
Product Specifications
Description
Source: Wheat Germ (in vitro)
Amino Acid Sequence: MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKLPCLPIHLSCRFLSV
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
Protein / Peptide Type
Scientific Data Images for Recombinant Human CDK20 GST (N-Term) Protein
SDS-PAGE: Recombinant Human CDK20 GST (N-Term) Protein [H00023552-P01]
SDS-Page: Recombinant Human CDK20 Protein [H00023552-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.Formulation, Preparation, and Storage
H00023552-P01
| Preparation Method | in vitro wheat germ expression system |
| Formulation | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: CDK20
Long Name
Alternate Names
Gene Symbol
Additional CDK20 Products
Product Documents for Recombinant Human CDK20 GST (N-Term) Protein
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Recombinant Human CDK20 GST (N-Term) Protein
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Citations for Recombinant Human CDK20 GST (N-Term) Protein
Powered by Bioz
Customer Reviews for Recombinant Human CDK20 GST (N-Term) Protein
There are currently no reviews for this product. Be the first to review Recombinant Human CDK20 GST (N-Term) Protein and earn rewards!
Have you used Recombinant Human CDK20 GST (N-Term) Protein?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for Recombinant Human CDK20 GST (N-Term) Protein
-
Q: Could you please let me know what was the expression system (E coli, insect cells,...?) of the CDK20 recombinant protein (H00023552-P01)?
A:
This protein was expressed in a cell-free wheat germ synthesis system. It has not been tested for any biological activity, and is mainly intended for use as a positive control with the corresponding antibodies. We actually distribute this item for a Taiwanese company called Abnova. Find more info about their wheat germ expression system (http://www.abnova.com/support/Protein.asp).
-
Q: What is the buffer composition of the product? I need the same buffer as a control for my experiment.
A: This protein is provided in 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0.
-
Q: Could you please let me know what was the expression system (E coli, insect cells,...?) of the CDK20 recombinant protein (H00023552-P01)?
A:
This protein was expressed in a cell-free wheat germ synthesis system. It has not been tested for any biological activity, and is mainly intended for use as a positive control with the corresponding antibodies. We actually distribute this item for a Taiwanese company called Abnova. Find more info about their wheat germ expression system (http://www.abnova.com/support/Protein.asp).
-
Q: What is the buffer composition of the product? I need the same buffer as a control for my experiment.
A: This protein is provided in 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0.