CENPE Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-24731

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CENPE Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein CENPE using the following amino acid sequence: EKIENLTRMLVTSSSLTLQQELKAKRKRRVTWCLGKINKMKNSNYADQFNIPTNITTKTHKLSINLLREIDESVCSESDVFSNTLDTLSEIEWNPATKLLNQENIESELNSLRADYDN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CENPE Antibody - BSA Free

CENPE Antibody Immunocytochemistry/Immunofluorescence: CENPE Antibody [NBP3-24731]

Immunocytochemistry/Immunofluorescence: CENPE Antibody [NBP3-24731]

Staining of human cell line U-251MG shows localization to microtubules, cytokinetic bridge & mitotic spindle.

Applications for CENPE Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CENPE

Centrosome-associated protein E is a kinesin-like motor protein that accumulates in the G2 phase of the cell cycle. Unlike other centrosome-associated proteins, it is not present during interphase and first appears at the centromere region of chromosomes during prometaphase. CENPE is proposed to be one of the motors responsible for mammalian chromosome movement and/or spindle elongation. [provided by RefSeq]

Long Name

Centromere-associated protein E

Alternate Names

CENP-E, Kinesin-7

Gene Symbol

CENPE

Additional CENPE Products

Product Documents for CENPE Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CENPE Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CENPE Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CENPE Antibody - BSA Free and earn rewards!

Have you used CENPE Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies