CRSP-1

   
Product Datasheet
Catalog Number:3555
Alternate Names:Calcitonin receptor-stimulating peptide-1
Chemical Name:
Product Details
Supplemental Products
Reviews
Biological Activity
Endogenous central calcitonin (CT) receptor agonist that stimulates cAMP formation at a potency 350-fold greater than CT (ED50 values are 0.2 and 71 nM respectively). Displays no activity at calcitonin-gene related peptide (CGRP) and adrenomedullin receptors. Inhibits formation of multinuclear osteoclasts with similar efficacy to CT in vitro. Suppresses food intake and increases body temperature in free-feeding rats, and significantly decreases plasma calcium levels in vivo.
Technical Data
  • M.Wt:
    4098.88
  • Formula:
    C175H294N54O49S5
  • Sequence:
    SCNTATCMTHRLVGLLSRSGSMVRSNLLPTKMGFKVFG

    (Modifications: Disulfide bridge between 2 - 7, Gly-38 = C-terminal amide)

  • Solubility:
    Soluble to 0.50 mg/ml in 10% acetonitrile / water
  • Storage:
    Store at -20°C
  • CAS No:
    697327-12-1
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Product Datasheets

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Have you used CRSP-1?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Contact Us to Order
reload

Feedback

Customer Information
Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee