Catalog Number: 3555
Alternate Names: Calcitonin receptor-stimulating peptide-1
Biological Activity
Endogenous central calcitonin (CT) receptor agonist that stimulates cAMP formation at a potency 350-fold greater than CT (ED50 values are 0.2 and 71 nM respectively). Displays no activity at calcitonin-gene related peptide (CGRP) and adrenomedullin receptors. Inhibits formation of multinuclear osteoclasts with similar efficacy to CT in vitro. Suppresses food intake and increases body temperature in free-feeding rats, and significantly decreases plasma calcium levels in vivo.
Technical Data
  • M.Wt:
    4098.88
  • Formula:
    C175H294N54O49S5
  • Sequence:
    SCNTATCMTHRLVGLLSRSGSMVRSNLLPTKMGFKVFG

    (Modifications: Disulfide bridge between 2 - 7, Gly-38 = C-terminal amide)

  • Solubility:
    Soluble to 0.50 mg/ml in 10% acetonitrile / water
  • Storage:
    Store at -20°C
  • CAS No:
    697327-12-1
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Central effects of calcitonin receptor-stimulating peptide-1 on energy homeostasis in rats.
    Sawada et al.
    Endocrinology, 2006;147:2043
  2. A novel member of the calcitonin gene-related peptide family, calcitonin receptor-stimulating peptide, inhibits the formation and activity of osteoclasts.
    Notoya et al.
    Eur.J.Pharmacol., 2007;560:234
  3. Calcitonin receptor-stimulating peptide, a new member of the calcitonin gene-related peptide family. Its isolation from porcine brain, structure, tissue distribution, and biological activity.
    Katafuchi et al.
    J.Biol.Chem., 2003;278:12046

Have you used CRSP-1?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

Feedback

Customer Information