CRSP-1

Catalog # Availability Size / Price Qty
3555/100U
CRSP-1
1 Image
Description: Endogenous central calcitonin agonist
Alternative Names: Calcitonin receptor-stimulating peptide-1
Product Details
Supplemental Products
Reviews

Biological Activity

Endogenous central calcitonin (CT) receptor agonist that stimulates cAMP formation at a potency 350-fold greater than CT (ED50 values are 0.2 and 71 nM respectively). Displays no activity at calcitonin-gene related peptide (CGRP) and adrenomedullin receptors. Inhibits formation of multinuclear osteoclasts with similar efficacy to CT in vitro. Suppresses food intake and increases body temperature in free-feeding rats, and significantly decreases plasma calcium levels in vivo.

Technical Data

M.Wt:
4098.88
Formula:
C175H294N54O49S5
Sequence:
SCNTATCMTHRLVGLLSRSGSMVRSNLLPTKMGFKVFG

(Modifications: Disulfide bridge between 2 - 7, Gly-38 = C-terminal amide)

Solubility:
Soluble to 0.50 mg/ml in 10% acetonitrile / water
Storage:
Store at -20°C
CAS No:
697327-12-1

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for CRSP-1

There are currently no reviews for this product. Be the first to review CRSP-1 and earn rewards!

Have you used CRSP-1?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.