DNA Primase small subunit Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-90897PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Applications

Antibody Competition
View all DNA Primase small subunit Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRIM1.

Source: E. coli

Amino Acid Sequence: ELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90897.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-90897PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: DNA Primase small subunit

DNA Primase small subunit, also known by its gene name PRIM1, is a heterodimer that is composed of a small and large subunit. PRIM1 is 420 amino acids long and approximately 49kDa. The DNA Primase small subunit synthesizes RNA primers for the Okazaki fragments created during discontinuous DNA replication. Current research surrounding PRIM1 has shown a possible link with carcinomas, malaria, neuronitis, and osteosarcoma. DNA Primase small subunit has also been shown to interact with Histone cluster 1 H4/A, H4/B, H4/C, H4/D and H4/E in pathways such as DNA replication, DNA strand elongation, polymerase switching, and lagging strand synthesis.

Alternate Names

DNA primase 1, DNA primase 49 kDa subunit, DNA primase small subunit, DNA primase subunit 48, EC 2.7.7, EC 2.7.7.-, MGC12308, p49, primase p49 subunit, primase polypeptide 1, 49kDa, primase, DNA, polypeptide 1 (49kDa)

Gene Symbol

PRIM1

Additional DNA Primase small subunit Products

Product Documents for DNA Primase small subunit Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DNA Primase small subunit Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for DNA Primase small subunit Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review DNA Primase small subunit Recombinant Protein Antigen and earn rewards!

Have you used DNA Primase small subunit Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes