Ephrin-A5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58251

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Mouse

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Validated:

Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Ephrin-A5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Ephrin-A5 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Ephrin-A5 Antibody [NBP2-58251]

Immunocytochemistry/ Immunofluorescence: Ephrin-A5 Antibody [NBP2-58251]

Immunocytochemistry/Immunofluorescence: Ephrin-A5 Antibody [NBP2-58251] - Staining of human cell line A-431 shows localization to cytosol & vesicles. Antibody staining is shown in green.

Applications for Ephrin-A5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 1 using NBP2-58251 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ephrin-A5

Ephrin A5, a member of the ephrin family, prevents axon bundling in cocultures of cortical neurons with astrocytes, a model of late stage nervous system development and differentiation. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. EPH receptors typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin ligands and receptors have been named by the Eph Nomenclature Committee (1997). Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are similarly divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.

Alternate Names

AL-1, EFL-5, EFNA5, EphrinA5, LERK-7, RAGS

Gene Symbol

EFNA5

Additional Ephrin-A5 Products

Product Documents for Ephrin-A5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Ephrin-A5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Ephrin Ligands and Eph Receptors

Citations for Ephrin-A5 Antibody - BSA Free

Customer Reviews for Ephrin-A5 Antibody - BSA Free (1)

1 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
100%

Have you used Ephrin-A5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Ephrin-A5 Antibody
    Name: Anonymous
    Application: Immunohistochemistry-Frozen
    Sample Tested: Mouse lens tissue
    Species: Mouse
    Verified Customer | Posted 07/28/2021
    Anterior Posterior section of mouse lens stained with Rabbit Anti-Ephrin-A5, Phalloidin-Rhodamine, and DAPI. The imaging revealed that there was no real signal in neither wild-type nor knockout samples.
    Ephrin-A5 Antibody - BSA Free NBP2-58251
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies