Huwentoxin IV

Discontinued Product

4718 has been discontinued.
View all Voltage-gated Sodium Channel Blockers products.
Huwentoxin IV
1 Image
Description: Selective NaV1.7 channel blocker
Product Details
Citations (1)
Reviews

Biological Activity

Huwentoxin IV is a selective NaV1.7 channel blocker. Preferentially inhibits neuronal NaV1.7, 1.2 and 1.3 (IC50 values are 26, 150 and 338 nM respectively), compared to muscle subtypes NaV1.4 and 1.5 (IC50 = >10 μM). Inhibits the channel by binding at the neurotoxin receptor site 4 in the S3-S4 linker of domain II, trapping the voltage sensor in the inward, closed configuration.

Technical Data

M.Wt:
4106.79
Formula:
C174H278N52O51S6
Sequence:
ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI

(Modifications: Disulfide bridge: 2-17,9-24,16-31)

(Modifications: Ile-35 = C-terminal amide)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
526224-73-7

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Citation for Huwentoxin IV

The citations listed below are publications that use Tocris products. Selected citations for Huwentoxin IV include:

1 Citation: Showing 1 - 1

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Huwentoxin IV

There are currently no reviews for this product. Be the first to review Huwentoxin IV and earn rewards!

Have you used Huwentoxin IV?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.