KCNK13 Antibody Blocking Peptide

Novus Biologicals | Catalog # NBP2-41132PEP

Novus Biologicals
Loading...

Key Product Details

Accession Number

Applications

Block/Neutralize
Loading...

Product Specifications

Description

A recombinant protein antigen 15 amino acids near the center of human KCNK13.

Source: E. coli

Amino Acid Sequence: DSTVIWRVLYNQGKQWLEATIQLGRLSQPFHLSLDKVSLGIYDGVSAIDDIRFENCTLPLPAESCEGLDHFWCRHTRACIEKLRLCD



Store KCNK13 Antibody Blocking Peptide at -20C, stable for one year.

Application Notes

KCNK13 peptide is used for blocking the activity of KCNK13 antibody NBP2-41132.

Protein / Peptide Type

Antibody Blocking Peptide

Scientific Data Images for KCNK13 Antibody Blocking Peptide

Western blot analysis of KCNK13 in rat brain tissue lysate

Western blot analysis of KCNK13 in rat brain tissue lysate with KCNK13 antibody at 0.5 ug/mL in (A) the absence and (B) the presence of blocking peptide.

Formulation, Preparation, and Storage

NBP2-41132PEP
Formulation PBS pH 7.2 (10 mM NaH2PO4, 10 mM Na2HPO4, 130 mM NaCl) containing 0.1% bovine serum albumin
Preservative 0.02% Sodium Azide
Concentration 0.2 mg/ml
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: KCNK13

The KCNK13 gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming domains. The product of this gene is an open channel that can be stimulated by arachidonic acid. (provided by RefSeq)

Alternate Names

K2p13.1, potassium channel subfamily K member 13, potassium channel, subfamily K, member 13, tandem pore domain potassium channel THIK-1, THIK-1

Gene Symbol

KCNK13

Additional KCNK13 Products

Product Documents for KCNK13 Antibody Blocking Peptide

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KCNK13 Antibody Blocking Peptide

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for KCNK13 Antibody Blocking Peptide

There are currently no reviews for this product. Be the first to review KCNK13 Antibody Blocking Peptide and earn rewards!

Have you used KCNK13 Antibody Blocking Peptide?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...