KCNK13 Antibody Blocking Peptide
Novus Biologicals | Catalog # NBP2-41132PEP
Key Product Details
Accession Number
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: DSTVIWRVLYNQGKQWLEATIQLGRLSQPFHLSLDKVSLGIYDGVSAIDDIRFENCTLPLPAESCEGLDHFWCRHTRACIEKLRLCD
Store KCNK13 Antibody Blocking Peptide at -20C, stable for one year.
Application Notes
Protein / Peptide Type
Scientific Data Images for KCNK13 Antibody Blocking Peptide
Western blot analysis of KCNK13 in rat brain tissue lysate
Western blot analysis of KCNK13 in rat brain tissue lysate with KCNK13 antibody at 0.5 ug/mL in (A) the absence and (B) the presence of blocking peptide.Formulation, Preparation, and Storage
NBP2-41132PEP
| Formulation | PBS pH 7.2 (10 mM NaH2PO4, 10 mM Na2HPO4, 130 mM NaCl) containing 0.1% bovine serum albumin |
| Preservative | 0.02% Sodium Azide |
| Concentration | 0.2 mg/ml |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: KCNK13
Alternate Names
Gene Symbol
UniProt
Additional KCNK13 Products
Product Documents for KCNK13 Antibody Blocking Peptide
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for KCNK13 Antibody Blocking Peptide
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Customer Reviews for KCNK13 Antibody Blocking Peptide
There are currently no reviews for this product. Be the first to review KCNK13 Antibody Blocking Peptide and earn rewards!
Have you used KCNK13 Antibody Blocking Peptide?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review