Liraglutide

Catalog # Availability Size / Price Qty
6517/1
Cat.No. 6517 - Liraglutide | His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-(γ-Glu-palmitoyl)-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly | CAS No. 204656-20-2
1 Image
Description: Highly potent, long-acting GLP-1 receptor agonist
Alternative Names: NN2211
Product Details
Reviews

Biological Activity

Highly potent, long-acting GLP-1 receptor agonist (EC50 = 61 pM). Acylated derivative of GLP-1 (7-37) (Cat. No. 5374). Inhibits food and water intake, causing lasting and reversible weight loss in normal and obese rats.

Technical Data

M.Wt:
3751.24
Formula:
C172H265N43O51
Sequence:
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG

(Modifications: Lys-20 = Lys-(γ-Glu-palmitoyl))

Solubility:
Soluble to 1 mg/ml in 0.01M PBS (pH 7.4)
Storage:
Store at -20°C
CAS No:
204656-20-2

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Liraglutide

There are currently no reviews for this product. Be the first to review Liraglutide and earn rewards!

Have you used Liraglutide?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.