Catalog Number: 5213
Biological Activity
Antimicrobial peptide derivative of human cathelicidin. Induces FPRL1-mediated chemotaxis of human neutrophils, monocytes and T cells in vitro. Promotes wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice. Also triggers apoptosis in colon cancer cells. Cell permeable.
Technical Data
  • M.Wt:
    4493.32
  • Formula:
    C205H340N60O53
  • Sequence:
    [LL-37, 37 aa]
  • Solubility:
    Soluble to 1 mg/ml in water
  • Storage:
    Store at -20°C
  • CAS No:
    154947-66-7
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilizes formyl peptide receptor-like 1 (FPRL1) as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cells.
    Yang et al.
    J.Exp.Med., 2000;192:1069
  2. Skin electroporation of a plasmid encoding hCAP-18/LL-37 host defense peptide promotes wound healing.
    Steinstraesser et al.
    Mol.Ther., 2014;22:734
  3. Host immune defense peptide LL-37 activates caspase-independent apoptosis and suppresses colon cancer.
    Ren et al.
    Cancer Res., 2012;72:6512
  4. Spotlight on human LL-37, an immunomodulatory peptide with promising cell-penetrating properties.
    Seil et al.
    Pharmaceuticals, 2010;3:3435

Have you used LL 37?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information