Biological Activity
LL 37 is an antimicrobial peptide derivative of human cathelicidin. Induces FPRL1-mediated chemotaxis of human neutrophils, monocytes and T cells in vitro. Promotes wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice. LL 37 reduces SARS-CoV-2 infection by blocking the receptor binding domain of the S1 spike protein (Kd = 11.2 nM) and by binding to ACE2 (Kd = 25.5.nM). LL 37 inhibits SARS-CoV-2 pseudovirion infection (IC50 = 4.74 μg/mL) in vitro and in vivo. Also triggers apoptosis in colon cancer cells. Cell permeable.Technical Data
M.Wt:
4493.32
Formula:
C205H340N60O53
Sequence:
[LL-37, 37 aa]
Solubility:
Soluble to 1 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C
CAS No:
154947-66-7
The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Complete Your Research
Background References
-
Spotlight on human LL-37, an immunomodulatory peptide with promising cell-penetrating properties.
Seil et al.
Pharmaceuticals, 2010;3:3435 -
LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilizes formyl peptide receptor-like 1 (FPRL1) as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cells.
Yang et al.
J.Exp.Med., 2000;192:1069 -
Skin electroporation of a plasmid encoding hCAP-18/LL-37 host defense peptide promotes wound healing.
Steinstraesser et al.
Mol.Ther., 2014;22:734 -
Host immune defense peptide LL-37 activates caspase-independent apoptosis and suppresses colon cancer.
Ren et al.
Cancer Res., 2012;72:6512
Product Datasheets
Or select another batch:
Reconstitution Calculator
Molarity Calculator
Reconstitution Calculator
Molarity Calculator
FAQs
No product specific FAQs exist for this product, however you may
View all Peptide FAQsReviews for LL 37
There are currently no reviews for this product. Be the first to review LL 37 and earn rewards!
Have you used LL 37?
Submit a review and receive an Amazon gift card.
$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Tocris Bioscience is the leading supplier of novel and exclusive
tools for
life science research with over 30 years' experience in the
industry.
Tocris is a Bio-Techne brand.