MATE1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-03733

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all MATE1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 460-550 of human MATE1 (NP_060712.2). LNWKKACQQAQVHANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQLVLRRGLLL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MATE1 Antibody - Azide and BSA Free

Western Blot: MATE1 AntibodyAzide and BSA Free [NBP3-03733]

Western Blot: MATE1 AntibodyAzide and BSA Free [NBP3-03733]

Western Blot: MATE1 Antibody [NBP3-03733] - Analysis of extracts of rat liver, using MATE1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.

Applications for MATE1 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MATE1

The MATE1 gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function. (provided by RefSeq)

Long Name

Multidrug and toxin extrusion protein 1

Alternate Names

hMATE-1, MATE-1, SLC47A1

Gene Symbol

SLC47A1

Additional MATE1 Products

Product Documents for MATE1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MATE1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for MATE1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review MATE1 Antibody - Azide and BSA Free and earn rewards!

Have you used MATE1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies