Mineralocorticoid R/NR3C2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57853

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Mineralocorticoid R/NR3C2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PSSAIVGVNSGGQSFHYRIGAQGTISLSRSARDQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Mineralocorticoid R/NR3C2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Mineralocorticoid R/NR3C2 Antibody [NBP2-57853]

Immunocytochemistry/ Immunofluorescence: Mineralocorticoid R/NR3C2 Antibody [NBP2-57853]

Immunocytochemistry/Immunofluorescence: Mineralocorticoid R/NR3C2 Antibody [NBP2-57853] - Staining of human cell line PC-3 shows localization to nucleoplasm.

Applications for Mineralocorticoid R/NR3C2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Mineralocorticoid R/NR3C2

Steroid receptors are ligand dependent, intracellular proteins that stimulate transcription of specific genes by binding to specific DNA sequences following activation by the appropriate hormone. Mineralocorticoids are a family of steroids, secreted by the adrenal cortex, necessary for the regulation of a number of metabolic processes including electrolyte regulation. These compounds exert their effect through their interaction with the mineralocorticoid receptor and that complex's subsequent association with DNA. Given the function of mineralocorticoids, it is not surprising to find that the kidney is a primary target organ for mineralocorticoids and that this organ has been shown to contain Mineralocorticoid Receptor.

Long Name

Mineralocorticoid Receptor

Alternate Names

MineralocorticoidR, MLR, NR3C2

Gene Symbol

NR3C2

Additional Mineralocorticoid R/NR3C2 Products

Product Documents for Mineralocorticoid R/NR3C2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Mineralocorticoid R/NR3C2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Mineralocorticoid R/NR3C2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Mineralocorticoid R/NR3C2 Antibody - BSA Free and earn rewards!

Have you used Mineralocorticoid R/NR3C2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies