MTHFD1L Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-37864PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MTHFD1L.

Source: E. coli

Amino Acid Sequence: HFGGLIEEDDVILLAAALRIQNMVSSGRRWLREQQHRRWRLHCLKLQPLSPVPSDIEISRGQTPKAVDVLAKEIGLLADEIEIYGKSKAKV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-37864.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-37864PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MTHFD1L

MTHFD1L, also known as Monofunctional C1-tetrahydrofolate synthase, mitochondrial, consists of 2 a 978 amino acid isoform1 that is 106 kDa and a 275 amino acid isoform 2 that is 30 kDa; has mitochondrion subcellular location and highest expression found in placenta, thymus and brain; it is involved in the synthesis of tetrahydrofolate (THF) in the mitochondrion which is important in the de novo synthesis of purines and thymidylate and in the regeneration of methionine from homocysteine, and also may provide the missing metabolic reaction required to link the mitochondria and the cytoplasm in the mammalian model of one-carbon folate metabolism in embryonic an transformed cells complementing thus the enzymatic activities of MTHFD2. Current research is being performed on this protein involvement in cleft lip/palate, neural tube defect, homocysteine, coronary heart disease, chronic myeloid leukemia, Down syndrome, colon adenocarcinoma, nephropathy, Alzheimer's disease, dementia, colorectal cancer, leukemia, and atherosclerosis. This protein plays role in One carbon pool by folate and Metabolic pathways where it interacts with CASP4, MAGED1, WRAP73, WDR8, MAP1LC3A, and plus more than 40 other proteins.

Alternate Names

10-formyl-THF synthetase, dJ292B18.2, DKFZp586G1517, EC 6.3.4.3, FLJ21145, Formyltetrahydrofolate synthetase, formyltetrahydrofolate synthetase domain containing 1, FTHFSDC1, methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like, mitochondrial C1-tetrahydrofolate synthase, mitochondrial C1-tetrahydrofolate synthetase, monofunctional C1-tetrahydrofolate synthase, mitochondrial, MTC1THFS

Gene Symbol

MTHFD1L

Additional MTHFD1L Products

Product Documents for MTHFD1L Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MTHFD1L Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for MTHFD1L Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review MTHFD1L Recombinant Protein Antigen and earn rewards!

Have you used MTHFD1L Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...