Myelin Protein Zero Antibody (3C4D1)

Novus Biologicals | Catalog # NBP3-33312

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 3C4D1
View all Myelin Protein Zero Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 149-248 of human Myelin Protein Zero (MPZ) (NP_000521.2).

Sequence:
KVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Myelin Protein Zero Antibody (3C4D1)

Myelin Protein Zero Antibody (3C4D1)

Western Blot: Myelin Protein Zero Antibody (3C4D1) [NBP3-33312] -

Western Blot: Myelin Protein Zero Antibody (3C4D1) [NBP3-33312] - Western blot analysis of various lysates using Myelin Protein Zero(MPZ) Rabbit mAb at1:19000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.

Applications for Myelin Protein Zero Antibody (3C4D1)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:2000 - 1:20000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Myelin Protein Zero

Myelin Protein Zero encodes a major structural protein of peripheral myelin. Mutations in this gene result in the autosomal dominant form of Charcot-Marie-Tooth disease type 1 as other polyneuropathies. [provided by RefSeq]

Alternate Names

Charcot-Marie-Tooth neuropathy 1B, CHM, CMT1, CMT1B, CMT2I, CMT2J, CMT4E, CMTDI3, HMSNIB, MPP, Myelin peripheral protein, myelin protein P0, myelin protein zeroDSS, P0

Gene Symbol

MPZ

Additional Myelin Protein Zero Products

Product Documents for Myelin Protein Zero Antibody (3C4D1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Myelin Protein Zero Antibody (3C4D1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Myelin Protein Zero Antibody (3C4D1)

There are currently no reviews for this product. Be the first to review Myelin Protein Zero Antibody (3C4D1) and earn rewards!

Have you used Myelin Protein Zero Antibody (3C4D1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies