Nephronectin Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-83990PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NPNT.

Source: E. coli

Amino Acid Sequence: RQCVNTFGSYICKCHKGFDLMYIGGKYQCHDIDECSLGQYQCSSFARCYNVRGSYKCKCKEGYQGDGLTCVYIPKVMIEPSGPIHVPKGNGTILKGDTGNNNWIPDVGSTWWPPKTPYIPPIITNRPTSKPTTRPTPK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83990.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-83990PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Nephronectin

Nephronectin, also called POEM (preosteoblast EGF repeat protein with MAM domain) is a 70 - 90 kDa extracellular matrix protein that is a ligand for integrin alpha8beta1. Nephronectin is most highly expressed in developing endocrine organs such as parathyroid, thyroid, hypophysis and pineal organ, and around developing bone, teeth, and muscle. Pre-osteoblast cells produce nephronectin, but downregulate it as they differentiate. It is also expressed in the Wolffian duct and ureteric bud basement membranes in the developing kidney, where it is colocalizes, and forms an in vivo complex with integrin alpha8beta1. Since deletion of integrin alpha8beta1 results in renal agenesis, nephronectin has been proposed to be a critical integrin alpha8beta1 ligand during nephrogenesis.

The 561 aa mouse nephronectin (isoform B) contains a 19 amino acid (aa) signal sequence, a matrilin-type vWA domain, two calcium-binding EGF-like domains, a potential N-linked glycosylation site, a pro/ser/thr-rich mucin-like region, an RGD integrin binding motif, and a MAM domain. These features are often present in matrix proteins that, like nephronectin, mediate cell adhesion and spreading. Isoform A includes a 17 aa insertion between aa # 58 and 59 that is missing in Nephronectin isoform B. Mouse nephronectin shows 88%, 92%, 85% and 77% aa identity with human, rat, cow and opossum nephronectin, respectively.

Alternate Names

EGFL6L, Nctn, NPNT, POEM

Gene Symbol

NPNT

Additional Nephronectin Products

Product Documents for Nephronectin Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Nephronectin Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Nephronectin Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review Nephronectin Recombinant Protein Antigen and earn rewards!

Have you used Nephronectin Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...