NPAS1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58842

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NPAS1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VLWVSHVLSQAEGGQTPLDAFQLPASVACEEASSPGPEPTEPEPPTEGKQAAPAENEAPQTQGQRIKV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NPAS1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: NPAS1 Antibody [NBP2-58842]

Immunocytochemistry/ Immunofluorescence: NPAS1 Antibody [NBP2-58842]

Immunocytochemistry/Immunofluorescence: NPAS1 Antibody [NBP2-58842] - Staining of human cell line HEK 293 shows localization to nucleoplasm.

Applications for NPAS1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NPAS1

NPAS1 is encoded by this gene is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. Studies of a related mouse gene suggest that it functions in neurons. The exact function of this gene is unclear, but it may play protective or modulatory roles during late embryogenesis and postnatal development. [provided by RefSeq].

Alternate Names

Basic-helix-loop-helix-PAS protein MOP5, BHLHE11, bHLHe11member of PAS superfamily 5, Class E basic helix-loop-helix protein 11, Member of PAS protein 5, MOP5Neuronal PAS1, neuronal PAS domain protein 1, neuronal PAS domain-containing protein 1, PASD5PAS domain-containing protein 5

Gene Symbol

NPAS1

Additional NPAS1 Products

Product Documents for NPAS1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NPAS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NPAS1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NPAS1 Antibody - BSA Free and earn rewards!

Have you used NPAS1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies