Recombinant Human NRK1 His Protein

Name: Recombinant Human NRK1 His Protein
Brand: Novus Biologicals
SKU: NBP1-98958
Price: 329 USD
Availability: InStock

Novus Biologicals | Catalog # NBP1-98958

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

E. coli

Tag

His

Applications

SDS-PAGE

View all NRK1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-199 of Human NRK1

Source: E.coli

Amino Acid Sequence: MGSSHHHHHHSSGLVPRGSHMGS>MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA

Purity

>90%, by SDS-PAGE

Predicted Molecular Mass

25.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human NRK1 His Protein

SDS-PAGE: Recombinant Human NRK1 His Protein [NBP1-98958]

SDS-Page: Recombinant Human MID2 Protein [NBP1-98958] - 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.

Formulation, Preparation, and Storage

NBP1-98958

Formulation	Phosphate-Buffered Saline (pH 7.4), 10% Glycerol
Preservative	No Preservative
Concentration	0.5 mg/ml
Shipping	The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NRK1

Nicotinamide adenine dinucleotide (NAD+) is essential for life in all organisms, both as a coenzyme for oxidoreductases and as a source of ADP-ribosyl groups used in various reactions. Nicotinic acid and nicotinamide, collectively known as niacin, are the vitamin precursors of NAD+. Nicotinamide riboside kinases, such as NRK1, function to synthesize NAD+ through nicotinamide mononucleotide using nicotinamide riboside as the precursor (Bieganowski and Brenner, 2004 [PubMed 15137942]).[supplied by OMIM]

Long Name

Nicotinamide riboside kinase 1

Alternate Names

C9orf95, NmR-K 1, NMRK1, NRK 1, RNK 1

Gene Symbol

NMRK1

Additional NRK1 Products

Product Documents for Recombinant Human NRK1 His Protein

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human NRK1 His Protein

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human NRK1 His Protein

There are currently no reviews for this product. Be the first to review Recombinant Human NRK1 His Protein and earn rewards!

Have you used Recombinant Human NRK1 His Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image