Oxyntomodulin (porcine, bovine)
Description: GLP-1 receptor agonist; endogenous preproglucagon derived peptide; modulates feeding and metabolism
Alternative Names: Glucagon (1-37), Enteroglucagon
Biological Activity
GLP-1 receptor agonist. Endogenous preproglucagon-derived neuropeptide that modulates feeding and metabolism. Also secreted by intestinal L-cells. Increases cAMP production and inhibits gastric acid secretion in rat stomach. Also weak glucagon receptor agonist.Technical Data
M.Wt:
4421.86
Formula:
C192H295N59O60S
Sequence:
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Solubility:
Soluble to 1 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
62340-29-8
The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Background References
-
Oxyntomodulin (glucagon-37) and its C-terminal octapeptide inhibit gastric acid secretion.
Jarrousse et al.
FEBS Lett., 1985;188:81 -
Bioactive enteroglucagon (oxyntomodulin): present knowledge on its chemical structure and its biological activities.
Bataille et al.
Peptides, 1981;2:41 -
A new role for enteric glucagon-37: acute stimulation of glucose absorption in rat small intestine.
Stumpel et al.
FEBS Lett., 1997;410:515 -
Preproglucagon derived peptides GLP-1, GLP-2 and oxyntomodulin in the CNS: role of peripherally secreted and centrally produced peptides.
Vrang and Larsen et al.
Prog.Neurobiol., 2010;92:442
Product Datasheets
Or select another batch:
Reconstitution Calculator
Molarity Calculator
Reconstitution Calculator
Molarity Calculator
FAQs
No product specific FAQs exist for this product, however you may
View all Peptide FAQsVersaClone cDNA Plasmids
Reviews for Oxyntomodulin (porcine, bovine)
There are currently no reviews for this product. Be the first to review Oxyntomodulin (porcine, bovine) and earn rewards!
Have you used Oxyntomodulin (porcine, bovine)?
Submit a review and receive an Amazon gift card.
$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Tocris Bioscience is the leading supplier of novel and exclusive
tools for
life science research with over 30 years' experience in the
industry.
Tocris is a Bio-Techne brand.