Oxyntomodulin (porcine, bovine)

Catalog # Availability Size / Price Qty
2094/1
Oxyntomodulin (porcine, bovine)
1 Image
Description: GLP-1 receptor agonist; endogenous preproglucagon derived peptide; modulates feeding and metabolism
Alternative Names: Glucagon (1-37), Enteroglucagon
Product Details
Supplemental Products
Reviews

Biological Activity

GLP-1 receptor agonist. Endogenous preproglucagon-derived neuropeptide that modulates feeding and metabolism. Also secreted by intestinal L-cells. Increases cAMP production and inhibits gastric acid secretion in rat stomach. Also weak glucagon receptor agonist.

Technical Data

M.Wt:
4421.86
Formula:
C192H295N59O60S
Sequence:
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Solubility:
Soluble to 1 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
62340-29-8

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

or select another batch:
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Oxyntomodulin (porcine, bovine)

There are currently no reviews for this product. Be the first to review Oxyntomodulin (porcine, bovine) and earn rewards!

Have you used Oxyntomodulin (porcine, bovine)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.