Catalog Number: 2094
Alternate Names: Glucagon (1-37), Enteroglucagon
Biological Activity
Endogenous glucagon-like peptide that modulates feeding and metabolism; secreted by intestinal L-cells. Increases cAMP production and inhibits gastric acid secretion in rat stomach.
Technical Data
  • M.Wt:
    4421.86
  • Formula:
    C192H295N59O60S
  • Sequence:
    HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
  • Solubility:
    Soluble to 1 mg/ml in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    62340-29-8
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Bioactive enteroglucagon (oxyntomodulin): present knowledge on its chemical structure and its biological activities.
    Bataille et al.
    Peptides, 1981;2:41
  2. A new role for enteric glucagon-37: acute stimulation of glucose absorption in rat small intestine.
    Stumpel et al.
    FEBS Lett., 1997;410:515
  3. Oxyntomodulin (glucagon-37) and its C-terminal octapeptide inhibit gastric acid secretion.
    Jarrousse et al.
    FEBS Lett., 1985;188:81

Have you used Oxyntomodulin (porcine, bovine)?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information