PAG608 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55349

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PAG608 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MILLQHAVLPPPKQPSPSPPMSVATRSTGTLQLPPQKPFGQEASLPLAGEEELSKGGEQDCALEELCKP

Reactivity Notes

Rat 80%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PAG608 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PAG608 Antibody [NBP2-55349]

Immunocytochemistry/ Immunofluorescence: PAG608 Antibody [NBP2-55349]

Immunocytochemistry/Immunofluorescence: PAG608 Antibody [NBP2-55349] - Staining of human cell line Hep G2 shows localization to nucleoplasm.

Applications for PAG608 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PAG608

PAG608 encodes a protein containing three zinc finger domains and a nuclear localization signal. The mRNA and the protein of this gene are upregulated by wildtype p53 and overexpression of this gene inhibits tumor cell growth, suggesting that this gene may have a role in the p53-dependent growth regulatory pathway. Alternative splicing of this gene results in two transcript variants encoding two isoforms differing in only one amino acid. [provided by RefSeq]

Alternate Names

FLJ31683, p53-activated gene 608 protein, WIG1matrin type 3, zinc finger, matrin-type 3

Gene Symbol

ZMAT3

Additional PAG608 Products

Product Documents for PAG608 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PAG608 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PAG608 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PAG608 Antibody - BSA Free and earn rewards!

Have you used PAG608 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies