PCK1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54720

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Porcine

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to PCK1 (phosphoenolpyruvate carboxykinase 1 (soluble)) The peptide sequence was selected from the middle region of PCK1. Peptide sequence NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

69 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PCK1 Antibody - BSA Free

Western Blot: PCK1 Antibody [NBP1-54720]

Western Blot: PCK1 Antibody [NBP1-54720]

Western Blot: PCK1 Antibody [NBP1-54720] - 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
Western Blot: PCK1 Antibody [NBP1-54720]

Western Blot: PCK1 Antibody [NBP1-54720]

Western Blot: PCK1 Antibody [NBP1-54720] - Antibody Positive control: Lane 1 : 80 ug pig serum Primary Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 500 Submitted by: Martina Ondrovics, University of Veterinary Medicine Vienna.

Applications for PCK1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PCK1

PCK1 is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of PCK1 can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet.This gene is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of this gene can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet. Defects in this gene are a cause of cytosolic phosphoenolpyruvate carboxykinase deficiency. A mitochondrial isozyme of the encoded protein also has been characterized. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Phosphoenolpyruvate Carboxykinase 1

Alternate Names

PEPCK-C, PEPCK1

Gene Symbol

PCK1

UniProt

Additional PCK1 Products

Product Documents for PCK1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PCK1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for PCK1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PCK1 Antibody - BSA Free and earn rewards!

Have you used PCK1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...