PEPD Antibody (5C7U8)

Novus Biologicals | Catalog # NBP3-33202

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 5C7U8
View all PEPD Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 400-493 of human PEPD (NP_000276.2).

Sequence:
ARHLQPGMVLTVEPGIYFIDHLLDEALADPARASFLNREVLQRFRGFGGVRIEEDVVVTDSGIELLTCVPRTVEEIEACMAGCDKAFTPFSGPK

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PEPD Antibody (5C7U8)

PEPD Antibody (5C7U8)

Western Blot: PEPD Antibody (5C7U8) [NBP3-33202] -

Western Blot: PEPD Antibody (5C7U8) [NBP3-33202] - Western blot analysis of various lysates using PEPD Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
PEPD Antibody (5C7U8)

Western Blot: PEPD Antibody (5C7U8) [NBP3-33202] -

Western Blot: PEPD Antibody (5C7U8) [NBP3-33202] - Western blot analysis of lysates from Mouse small intestine, using PEPD Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.

Applications for PEPD Antibody (5C7U8)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PEPD

The PEPD gene encodes a member of the peptidase family. The protein forms a homodimer that hydrolyzes dipeptides or tripeptides with C-terminal proline or hydroxyproline residues. The enzyme serves an important role in the recycling of proline, and may be rat

Alternate Names

aminoacyl-L-proline hydrolase, EC 3.4.13.9, Imidodipeptidase, MGC10905, peptidase Dimidodipeptidase, PRD, PROLIDASE, Proline dipeptidase, xaa-Pro dipeptidase, X-Pro dipeptidase

Gene Symbol

PEPD

Additional PEPD Products

Product Documents for PEPD Antibody (5C7U8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PEPD Antibody (5C7U8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PEPD Antibody (5C7U8)

There are currently no reviews for this product. Be the first to review PEPD Antibody (5C7U8) and earn rewards!

Have you used PEPD Antibody (5C7U8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies