PMS2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56323

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PMS2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MHAADLEKPMVEKQDQSPSLRTGEEKKDVSISRLREAFSLRHTTENKPHSPKTPEPRRS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PMS2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PMS2 Antibody [NBP2-56323]

Immunocytochemistry/ Immunofluorescence: PMS2 Antibody [NBP2-56323]

Immunocytochemistry/Immunofluorescence: PMS2 Antibody [NBP2-56323] - Staining of human cell line HaCaT shows localization to nucleoplasm & cytoplasmic bodies.

Applications for PMS2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PMS2

PMS2 is one of the PMS2 gene family members found in clusters on chromosome 7. The product of this gene is involved in DNA mismatch repair. It forms a heterodimer with MLH1 and this complex interacts with other complexes bound to mismatched bases. Mutations in this gene are associated with hereditary nonpolyposis colorectal cancer, Turcot syndrome, and are a cause of supratentorial primitive neuroectodermal tumors. Alternatively spliced transcript variants have been observed for this gene.

Alternate Names

DNA mismatch repair protein PMS2, EC 3.1, H_DJ0042M02.9, HNPCC4postmeiotic segregation increased (S. cerevisiae) 2, mismatch repair endonuclease PMS2, PMS1 protein homolog 2, PMS2 postmeiotic segregation increased 2 (S. cerevisiae), PMSL2PMS2CL

Gene Symbol

PMS2

Additional PMS2 Products

Product Documents for PMS2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PMS2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PMS2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PMS2 Antibody - BSA Free and earn rewards!

Have you used PMS2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies