Pramlintide

Catalog # Availability Size / Price Qty
5031/500U
Cat.No. 5031 - Pramlintide | KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY(Modifications: Disulfide bridge: 2-7)(Modifications: Tyr-37 = C-terminal amide) | CAS No. 151126-32-8
1 Image
Description: Synthetic version of amylin (Cat. No. 3418)
Product Details
Supplemental Products
Reviews

Biological Activity

Synthetic version of amylin (Cat. No. 3418). Exhibits high affinity for amylin, CGRP and calcitonin receptors (Ki values are 0.023, 3.8 and 5.1 nM respectively). Reduces postprandial hyperglycemia; also inhibits gastric emptying.

Technical Data

Formula:
C171H267N51O53S2
Sequence:
Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2
Solubility:
Soluble to 1 mg/ml in water
Storage:
Store the unopened product at -20 to -70 °C. Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Do not use past expiration date.
CAS No:
151126-32-8

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.

Background References

  1. Pramlintide, the synthetic analogue of amylin: phsyiology, pathophysiology, and effects on glycemic control, body weight, and selected biomarkers of vascular risk.
    Hoogwerf et al.
    Vasc.Health Risk Manag., 2008;4:355
  2. Preclinical pharmacology of pramlintide in the rat: comparisons with human and rat amylin.
    Young et al.
    Drug Dev.Res., 1996;37:231

Product Datasheets

or select another batch:
Reconstitution Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Tocris Peptides

Amylin

VersaClone cDNA Plasmids

Reviews for Pramlintide

There are currently no reviews for this product. Be the first to review Pramlintide and earn rewards!

Have you used Pramlintide?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.