PRKCDBP Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35738

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PRKCDBP Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 75-160 of human PRKCDBP (NP_659477.2).

Sequence:
SNTLAQLLAKAERVSSHANAAQERAVRRAAQVQRLEANHGLLVARGKLHVLLFKEEGEVPASAFQKAPEPLGPADQSELGPEQLEA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PRKCDBP Antibody - BSA Free

PRKCDBP Antibody

Western Blot: PRKCDBP Antibody [NBP3-35738] -

Western Blot: PRKCDBP Antibody [NBP3-35738] - Western blot analysis of lysates from Rat heart, using PRKCDBP Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for PRKCDBP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PRKCDBP

PRKCDBP, also known as Protein kinase C delta-binding protein, is 261 amino acids in length and approximately 27kDa. PRKCDBP is highly expressed in epithelial cells, and is down regulated in lung cancer cell lines and breast cancer cell lines, thus suggesting the possibility of tumor suppressor function. PRKCDBP binds and is phosphorylated by protein kinase C, delta. Current research surrounding PRKCDBP shows a possible connection with ovarian cancer, gastric cancer and lung cancer. PRKCDBP has also been shown to interact with Caveolin 1, Caveolin 3, cMyc, SDPR, and EPS15L1.

Alternate Names

cavin-3, HSRBC, MGC20400, protein kinase C, delta binding protein, sdr-related gene product that binds to c-kinase, Serum deprivation response factor-related gene product that binds to C-kinase, SRBCprotein kinase C delta-binding protein

Gene Symbol

CAVIN3

Additional PRKCDBP Products

Product Documents for PRKCDBP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PRKCDBP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PRKCDBP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PRKCDBP Antibody - BSA Free and earn rewards!

Have you used PRKCDBP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies