PSF3 Antibody [Biotin]

Novus Biologicals | Catalog # NBP3-76885

Fc Region Site-Specific Biotinylated Antibody
Novus Biologicals

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Biotin

Antibody Source

Polyclonal Rabbit IgG
View all PSF3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

This conjugate is made on demand and is not held in inventory. As a result, each order represents a unique lot.

Successful site-specific biotin conjugation is confirmed by reducing SDS-PAGE, revealing a mobility shift of the antibody heavy-chain when biotin is covalently attached. Free biotin from the conjugation process has been removed. The antibody concentration is provided on the individual product label.

For specialized conjugation needs, like large quantities, and specific concentrations, bulk and custom antibody conjugation services are available.

Applications for PSF3 Antibody [Biotin]

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Recommended applications and dilutions are based on validated applications from the unconjugated base product

NBP2-57457

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

40% glycerol and PBS (pH 7.2).

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: PSF3

PSF3, also known as DNA replication complex GINS protein PSF3, has a 138 amino acid long isoform that is 25 kDa and a short 138 amino acid that is approx. 16 kDa, is located in the nucleus and plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. Studies on this protein have shown a relationship with colon cancer and long QT syndrome. This protein has been studied in DNA replication where it interacts with PSMA4, WDHD1, PSMA6 and MCM6.

Alternate Names

DNA replication complex GINS protein PSF3, GINS complex subunit 3, GINS complex subunit 3 (Psf3 homolog), PSF3FLJ13912

Gene Symbol

GINS3

Additional PSF3 Products

Product Documents for PSF3 Antibody [Biotin]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PSF3 Antibody [Biotin]

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PSF3 Antibody [Biotin]

There are currently no reviews for this product. Be the first to review PSF3 Antibody [Biotin] and earn rewards!

Have you used PSF3 Antibody [Biotin]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies