PSTPIP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-25077

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PSTPIP1 Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein PSTPIP1 using the following amino acid sequence: GMIKRFSGLLHGSPKTTSLAASAASTETLTPTPERNEGVYTAIAVQEIQGNPASPAQEYRALYDYTAQNPDELDLSAGDILEVILEGEDGWWTVERNGQRGFVPGSYLEK

Reactivity Notes

Mouse (84%), Rat (80%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PSTPIP1 Antibody - BSA Free

PSTPIP1 Antibody Immunocytochemistry/Immunofluorescence: PSTPIP1 Antibody [NBP3-25077]

Immunocytochemistry/Immunofluorescence: PSTPIP1 Antibody [NBP3-25077]

Staining of human cell line THP-1 shows localization to plasma membrane & cytosol.

Applications for PSTPIP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PSTPIP1

The protein encoded by the PSTPIP1 gene binds to the cytoplasmic tail of CD2, an effector of T cell activation and adhesion, negatively affecting CD2-triggered T cell activation. The encoded protein appears to be a scaffold protein and a regulator of the actin cytoskeleton. It has also been shown to bind ABL1, PTPN18, WAS, CD2AP, and PTPN12. Mutations in this gene are a cause of PAPA syndrome. (provided by RefSeq)

Alternate Names

CD2BP1CD2-binding protein 1, CD2BP1L, CD2BP1S, H-PIPPEST phosphatase-interacting protein 1, PAPASCD2 antigen-binding protein 1, proline-serine-threonine phosphatase interacting protein 1, proline-serine-threonine phosphatase-interacting protein 1, PSTPIPCD2 cytoplasmic tail-binding protein

Gene Symbol

PSTPIP1

Additional PSTPIP1 Products

Product Documents for PSTPIP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PSTPIP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PSTPIP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PSTPIP1 Antibody - BSA Free and earn rewards!

Have you used PSTPIP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies