SEC22C Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57179

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SEC22C Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TASYDTTCIGLASRPYAFLEFDSIIQKVKWHFNYVSSSQMECSLEKIQEELKLQPPAVLTLEDTDVANGVMNGHTPMHL

Reactivity Notes

Mouse 80%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit SEC22C Antibody - BSA Free (NBP2-57179) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for SEC22C Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SEC22C Antibody [NBP2-57179]

Immunocytochemistry/ Immunofluorescence: SEC22C Antibody [NBP2-57179]

Immunocytochemistry/Immunofluorescence: SEC22C Antibody [NBP2-57179] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus.

Applications for SEC22C Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SEC22C

SEC22C is encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It is localized at the endoplasmic reticulum and it is thought to play a role in the early stages of the ER-Golgi protein trafficking. There are two alternatively spliced transcript variants encoding different isoforms described for this gene.

Alternate Names

DKFZp761F2321, MGC13261, MGC5373, SEC22 vesicle trafficking protein homolog C (S. cerevisiae), SEC22 vesicle trafficking protein-like 3, SEC22 vesicle trafficking protein-like 3 (S. cerevisiae), SEC22 vesicle-trafficking protein homolog C, SEC22 vesicle-trafficking protein-like 3, SEC22L3, secretion deficient 22C, vesicle-trafficking protein SEC22c

Gene Symbol

SEC22C

Additional SEC22C Products

Product Documents for SEC22C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SEC22C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SEC22C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SEC22C Antibody - BSA Free and earn rewards!

Have you used SEC22C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies