Recombinant Human Secretin GST (N-Term) Protein

Novus Biologicals | Catalog # H00006343-P01

Novus Biologicals
100% Guarantee

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE
View all Secretin Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-121 of Human SCT

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQDAENSMAWTRLSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRPR

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

39.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Secretin GST (N-Term) Protein

SDS-PAGE: Recombinant Human Secretin GST (N-Term) Protein [H00006343-P01]

SDS-PAGE: Recombinant Human Secretin GST (N-Term) Protein [H00006343-P01]

SDS-Page: Recombinant Human Secretin Protein [H00006343-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00006343-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Secretin

Secretin belongs to the glucagon family. This protein is an endocrine hormone and its major site of production is the endocrine S cells located in the proximal small intestinal mucosa. The release of active secretin is stimulated by either fatty acids or an acidic pH in the duodenum. This hormone stimulates the secretion of bicarbonate-rich pancreatic fluids and has also been shown to regulate the growth and development of the stomach, small intestine, and pancreas. Secretin deficiency has been implicated in autistic syndrome, suggesting that the hormone could have a neuroendocrine function in addition to its role in digestion. [provided by RefSeq]

Alternate Names

secretin

Gene Symbol

SCT

Additional Secretin Products

Product Documents for Recombinant Human Secretin GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human Secretin GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human Secretin GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human Secretin GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human Secretin GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes