SLC4A4 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-32020PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC4A4.

Source: E. coli

Amino Acid Sequence: KKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32020.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-32020PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SLC4A4

SLC4A4 - solute carrier family 4, sodium bicarbonate cotransporter, member 4

Alternate Names

electrogenic sodium bicarbonate cotransporter 1, hhNMC, HNBC1, KNBC, kNBC1, Na(+)/HCO3(-) cotransporter, NBC, NBC1DKFZp781H1314, NBC2, NBCE1, pNBC, SLC4A5, Sodium bicarbonate cotransporter, sodium bicarbonate cotransporter 1 (sodium bicarbonate cotransporter, kidney;sodium bicarbonate cotransporter, pancreas), Solute carrier family 4 member 4, solute carrier family 4, sodium bicarbonate cotransporter, member 4, solute carrier family 4, sodium bicarbonate cotransporter, member 4, brain type, solute carrier family 4, sodium bicarbonate cotransporter, member 5

Gene Symbol

SLC4A4

Additional SLC4A4 Products

Product Documents for SLC4A4 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC4A4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for SLC4A4 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review SLC4A4 Recombinant Protein Antigen and earn rewards!

Have you used SLC4A4 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for SLC4A4 Recombinant Protein Antigen

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Have any of your SLC4A4 antibodies been tested for use in IHC?

    A: The SLC4A4 antibodies have not been tested, or validated in IHC at this time. We will guarantee all listed applications and species. Should you wish to test in this new application, we would recommend our Innovators Reward Program. Under the terms of this program, you are eligible for a full credit of the price of this antibody in exchange for your data on IHC use. Eligibility for the credit is regardless of positive or negative results, as the data is still useful.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...