SNRPG Antibody (2H8-1C12) - Azide and BSA Free

Novus Biologicals | Catalog # H00006637-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 2H8-1C12

Format

Azide and BSA Free
View all SNRPG Primary Antibodies »

Product Specifications

Immunogen

SNRPG (AAH00070, 1 a.a. ~ 76 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV

Specificity

SNRPG - small nuclear ribonucleoprotein polypeptide G

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for SNRPG Antibody (2H8-1C12) - Azide and BSA Free

Western Blot: SNRPG Antibody (2H8-1C12) [H00006637-M01]

Western Blot: SNRPG Antibody (2H8-1C12) [H00006637-M01]

Western Blot: SNRPG Antibody (2H8-1C12) [H00006637-M01] - SNRPG monoclonal antibody (M01), clone 2H8-1C12 Analysis of SNRPG expression in Hela S3 NE.
Western Blot: SNRPG Antibody (2H8-1C12) [H00006637-M01]

Western Blot: SNRPG Antibody (2H8-1C12) [H00006637-M01]

Western Blot: SNRPG Antibody (2H8-1C12) [H00006637-M01] - Analysis of SNRPG expression in transfected 293T cell line by SNRPG monoclonal antibody (M01), clone 2H8-1C12.Lane 1: SNRPG transfected lysate(8.5 KDa).Lane 2: Non-transfected lysate.

Applications for SNRPG Antibody (2H8-1C12) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: SNRPG

Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5

Alternate Names

MGC117317, PBSCG, small nuclear ribonucleoprotein G, small nuclear ribonucleoprotein polypeptide G, SMG, Sm-GSm protein G, snRNP-G

Entrez Gene IDs

6637 (Human)

Gene Symbol

SNRPG

OMIM

603542 (Human)

UniProt

AAH00070 (Human)

Additional SNRPG Products

Product Documents for SNRPG Antibody (2H8-1C12) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SNRPG Antibody (2H8-1C12) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SNRPG Antibody (2H8-1C12) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SNRPG Antibody (2H8-1C12) - Azide and BSA Free and earn rewards!

Have you used SNRPG Antibody (2H8-1C12) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies