TCEB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58862

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TCEB1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TCEB1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TCEB1 Antibody [NBP2-58862]

Immunocytochemistry/ Immunofluorescence: TCEB1 Antibody [NBP2-58862]

Immunocytochemistry/Immunofluorescence: TCEB1 Antibody [NBP2-58862] - Staining of human cell line U-2 OS shows localization to cell junctions. Antibody staining is shown in green.

Applications for TCEB1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TCEB1

Elongin C (also known as RNA polymerase II transcription factor SIII p15 subunit and transcription elongation factor B polypeptide 1) is a 15 kD member of the SKP1 family. Elongin functions as a regulatory subunit of a general transcription elongation factor that increases RNA polymerase II transcription elongation past template-encoded arresting sites in the nucleus. The Elongin BC complex acts as adaptor to link Elongin A, VHL, WSB1 or SOCS1 with a module of CUL2 or CUL5 and RBX1 to form E3 ubiquitin ligases. The Poly6131 antibody recognizes the human and mouse elongin C protein and has been shown to be useful for Western blotting.

Long Name

TCEB1

Alternate Names

ELOC, elongin 15 kDa subunit, elongin-C, RNA polymerase II transcription factor SIII subuni, SIII, SIII p15, transcription elongation factor B (SIII), polypept, transcription elongation factor B polypeptide 1, transcription elongation factor B subunit 1

Gene Symbol

ELOC

Additional TCEB1 Products

Product Documents for TCEB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TCEB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TCEB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TCEB1 Antibody - BSA Free and earn rewards!

Have you used TCEB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies