TopBP1 Antibody [Biotin]

Novus Biologicals | Catalog # NBP3-75116

Fc Region Site-Specific Biotinylated Antibody
Novus Biologicals

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Biotin

Antibody Source

Polyclonal Rabbit IgG
View all TopBP1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KYEAAKKWNLPAVTIAWLLETARTGKRADESHFLIENSTKEERSLETEITNGINLNSDTAEHPGTRLQTHRKTVVTPLDMNRFQSKAFRAVVS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. Successful site-specific biotin conjugation is confirmed by reducing SDS-PAGE, revealing a mobility shift of the antibody heavy-chain when biotin is covalently attached. Additional information may be available upon request. The antibody concentration is provided on the individual product label. For specialized conjugation needs, like large quantities, and specific concentrations, bulk and custom antibody conjugation services are available.

Applications for TopBP1 Antibody [Biotin]

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Recommended applications and dilutions are based on validated applications from the unconjugated base product NBP2-55483

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

40% glycerol and PBS (pH 7.2).

Preservative

0.02% Sodium Azide

Concentration

0.1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: TopBP1

DNA topoisomerase II-binding protein 1 (TopBP1) is a protein that interacts with the C-terminal region of topoisomerase II beta (Topo II beta). TopBP1 function has been found to be important to various aspects of cellular growth control such as DNA replication, the DNA damage checkpoint, and cell survival. TopBP1 interacts with several proteins through its BRCA1 C-terminal (BRCT) motifs. TopBP1 interacts and inhibits E2F1 transcriptional activity through an Rb-independent mechanism that involves recruitment of the SWI/SNF chromatin-remodeling complex proteins Brg1 and Brm.

Long Name

DNA Topoisomerase II Binding Protein 1

Alternate Names

TOP2BP1

Gene Symbol

TOPBP1

Additional TopBP1 Products

Product Documents for TopBP1 Antibody [Biotin]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TopBP1 Antibody [Biotin]

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers

Customer Reviews for TopBP1 Antibody [Biotin]

There are currently no reviews for this product. Be the first to review TopBP1 Antibody [Biotin] and earn rewards!

Have you used TopBP1 Antibody [Biotin]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies