UBLCP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55421

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Biological Validation

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all UBLCP1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to UBLCP1(ubiquitin-like domain containing CTD phosphatase 1) The peptide sequence was selected from the N terminal of UBLCP1. Peptide sequence MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for UBLCP1 Antibody - BSA Free

Western Blot: UBLCP1 Antibody [NBP1-55421]

Western Blot: UBLCP1 Antibody [NBP1-55421]

Western Blot: UBLCP1 Antibody [NBP1-55421] - Lanes: 1: CD4 T cell lysate from WT mice, 2: CD4 T cell lysate from WT mice treated with anti-CD3/CD28, 3: CD4 T cell lysate from WT mice treated with FK506, 4: CD4 T cell lysate from WT mice treated with anti-CD3/CD28 and FK506, 5: CD4 T cell lysate from
Western Blot: UBLCP1 Antibody [NBP1-55421]

Western Blot: UBLCP1 Antibody [NBP1-55421]

Western Blot: UBLCP1 Antibody [NBP1-55421] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:1562500 Positive Control: Human Thymus

Applications for UBLCP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UBLCP1

UBLCP1 may specifically dephosphorylate 'Ser-5' of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit.

Alternate Names

CPUB1, CTD phosphatase-like with ubiquitin domain 1, CTD-like phosphatase domain-containing protein, EC 3.1.3.16, FLJ25267, MGC10067, ubiquitin-like domain containing CTD phosphatase 1, ubiquitin-like domain-containing CTD phosphatase 1

Gene Symbol

UBLCP1

UniProt

Q8WVY7 (Human)

Additional UBLCP1 Products

Product Documents for UBLCP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for UBLCP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UBLCP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UBLCP1 Antibody - BSA Free and earn rewards!

Have you used UBLCP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies